|
HS Code |
705487 |
| Product Name | Glucagon-Like Peptide-1 Raw Material |
| Synonym | GLP-1 |
| Cas Number | 106612-94-6 |
| Molecular Formula | C149H229N39O42S |
| Molecular Weight | 3297.74 g/mol |
| Appearance | White to off-white powder |
| Purity | ≥98% (HPLC) |
| Storage Temperature | -20°C |
| Solubility | Water soluble |
| Peptide Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR |
| Usage | Pharmaceutical research and development |
| Origin | Synthetic |
As an accredited Glucagon-Like Peptide-1 Raw Material factory, we enforce strict quality protocols—every batch undergoes rigorous testing to ensure consistent efficacy and safety standards.
| Packing | White, tamper-evident HDPE bottle containing 10 grams Glucagon-Like Peptide-1 raw powder, labeled with product information, batch number, and expiry date. |
| Storage | Glucagon-Like Peptide-1 (GLP-1) raw material should be stored at -20°C or lower, in a tightly sealed container, protected from light, moisture, and air. The storage area must be clean, dry, and well-ventilated, with restricted access to authorized personnel. Avoid repeated freeze-thaw cycles to maintain peptide stability and prevent degradation. |
| Shipping | Glucagon-Like Peptide-1 Raw Material is shipped in tightly sealed, sterile, and clearly labeled containers to prevent contamination and degradation. It is typically transported under temperature-controlled conditions, often with ice packs or dry ice, to maintain stability and ensure product integrity during transit. Proper documentation accompanies each shipment for compliance and traceability. |
Competitive Glucagon-Like Peptide-1 Raw Material prices that fit your budget—flexible terms and customized quotes for every order.
For samples, pricing, or more information, please contact us at +8615380400285 or mail to sales2@liwei-chem.com.
We will respond to you as soon as possible.
Tel: +8615380400285
Email: sales2@liwei-chem.com
Providing high-quality chemical products and logistics solutions for global trade partners.
